PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_95226g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 391aa    MW: 43706 Da    PI: 8.2181
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_95226g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.2e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd++lv ++++ G g+W++ ++  g+ R++k+c++rw +yl
    MA_95226g0010 14 RGPWTPEEDKILVSYIQKKGHGSWRALPKLAGLLRCGKSCRLRWTNYL 61
                     89******************************99************97 PP

2Myb_DNA-binding54.62.4e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+eE+  ++++++ lG++ W++Ia+ ++ gRt++++k++w+++l
    MA_95226g0010  67 RGSFTQEEERTIIQLHAILGNR-WSAIAAQLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-23564IPR009057Homeodomain-like
PROSITE profilePS5129415.243961IPR017930Myb domain
SuperFamilySSF466892.01E-2911108IPR009057Homeodomain-like
SMARTSM007179.5E-131363IPR001005SANT/Myb domain
PfamPF002499.5E-161461IPR001005SANT/Myb domain
CDDcd001674.42E-101661No hitNo description
PROSITE profilePS5129425.91162116IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.8E-2765116IPR009057Homeodomain-like
SMARTSM007171.9E-1766114IPR001005SANT/Myb domain
PfamPF002493.4E-1667112IPR001005SANT/Myb domain
CDDcd001672.88E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009909Biological Processregulation of flower development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MGRAPCCEKT GIKRGPWTPE EDKILVSYIQ KKGHGSWRAL PKLAGLLRCG KSCRLRWTNY  60
LRSDIKRGSF TQEEERTIIQ LHAILGNRWS AIAAQLPGRT DNEIKNFWNT HLKKRLLKMG  120
LDPSTHAPKS EASSSAAQGY GALALTRHKV QWENARLEAE ARLSRESLLM FSNTANGYPL  180
ITMPSNKPPT DYFLKIWNSE AGKAFRKESS SRMINKSREN SCHVFDKNDP NGRGYDEVLS  240
SEIPKTPRLS ASVSSSSCAS TQNSCDESLN PNHKNKDNGS QQCNSASADW IGDCIVKSPE  300
ILSCFADVTV GQTGHKTPED FFRFEKLGPP HVHFTGFLEL PLDNDNNNIG CMISELTTSF  360
QQQSASPWPE LHLEDDNDYW NNASFIASAH S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00114ampDAPTransfer from AT3G61250Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1186100.0BT118610.1 Picea glauca clone GQ04008_C24 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010523735.11e-98PREDICTED: transcription repressor MYB6
TrEMBLA0A067H2J72e-97A0A067H2J7_CITSI; Uncharacterized protein
TrEMBLV4TDD22e-97V4TDD2_9R
STRINGfgenesh1_pm.C_scaffold_50021023e-94(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.12e-97myb domain protein 17